Q5TA82 LCE2D_HUMAN

Gene name: LCE2D
Protein name: Late cornified envelope protein 2D

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5TA81 LCE2C 0.71758 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q15323 KRT31 0.71665 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
3 P0C0E4 RAB40AL 0.67216 cellular protein modification process GO:0006464
protein transport GO:0015031
signal transduction GO:0007165
...
4 Q5T754 LCE1F 0.66434 anatomical structure development GO:0048856
cell differentiation GO:0030154
5 O14633 LCE2B 0.64535 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q16671 AMHR2 0.63661 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
reproduction GO:0000003
...
7 P22531 SPRR2E 0.63264 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
8 Q8WXH6 RAB40A 0.6141 cellular protein modification process GO:0006464
protein transport GO:0015031
signal transduction GO:0007165
...
9 Q5T7P2 LCE1A 0.61337 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
10 Q5T752 LCE1D 0.60898 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877

                                           20                  40                  60                  80                 100
AA:                      MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCESEPSGAS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDDD...................DDDDD.............
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDDD...................DDDDD.............
CONSENSUS_MOBI:          ....................................................................................................
RICH_[PQ]:                  QQnQQQcQPPPkcPPkctPkcPP                                                                          
RICH_[C]:                  CqqnqqqCqpppkCppkCtpkCppkCppkCppqCpapCspavssCC                                                    
RICH_[K]:                              KcppKctpKcppKcppK                                                                     
RICH_[P]:                           PPPkcPPkctPkcPPkcPPkcPPqcPaPcsP                                                          
RICH_[CK]:                        CqpppKCppKCtpKCppKCppKCppqC                                                                
RICH_[CP]:                 CqqnqqqCqPPPkCPPkCtPkCPPkCPPkCPPqCPaPCsPavssCC                                                    
RICH_[CQ]:                 CQQnQQQCQpppkCppkCtpkC                                                                            
RICH_[KP]:                          PPPKcPPKctPKcPPKcPPKcPPqcP                                                               
RICH_fLPS_[P]:                      PPPkcPPkctPkcPPkcPPkcPPqcPaPcsP                                                          
RICH_fLPS_[Q]:           mscQQnQQQcQpppkcppkc                                                                                
RICH_fLPS_[C]:             CqqnqqqCqpppkCppkCtpkCppkCppkCppqCpapCspavssCC                                                    
RICH_fLPS_[CQP]:           CQQnQQQCQPPPkCPPkCtPkCPPkCPPkCPPQCPaPCsP                                                          
RICH_fLPS_[CPQ]:           CQQnQQQCQPPPkCPPkCtPkCPPkCPPkCPPQCPaPC                                                            

                                   
AA:                      GCCHSSGGCC
STMI:                              
DO_DISOPRED3:            ..........
DO_IUPRED2A:             ..........
DO_SPOTD:                DDDDDDDD..
CONSENSUS:               ..........
CONSENSUS_MOBI:          ..........