Q5TA89 HES5_HUMAN

Gene name: HES5
Protein name: Transcription factor HES-5

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- embryo development GO:0009790
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96GE9 DMAC1 0.9486 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 Q53GA4 PHLDA2 0.90818 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
3 Q8N5X7 EIF4E3 0.90696
4 Q96AD5 PNPLA2 0.90211 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
5 O00303 EIF3F 0.89239 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
6 P63027 VAMP2 0.88489 cell-cell signaling GO:0007267
cellular component assembly GO:0022607
immune system process GO:0002376
...
7 A6NEQ2 FAM181B 0.87502
8 Q5JR12 PPM1J 0.87491
9 Q8TF64 GIPC3 0.87045
10 P27694 RPA1 0.86226 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD.D..............................................................................
DO_IUPRED2A:             ..................DDDDDDD........................D..DDD.............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDD.................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDD..............................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160              
AA:                      QFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
STMI:                                                                                      
DO_DISOPRED3:            .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
DO_IUPRED2A:             .........................DDDDDDDDDDDDDDDDDDD.DDDD.................
DO_SPOTD:                ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS:               .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS_MOBI:          ........................DDDDDDDDDDDDDDDDDDDD......................
RICH_[AP]:                                    PPAAPAAPAkePkAPgAAPPPAlsAkAtAAAAAA           
RICH_[A]:                                       AApAApAkepkApgAApppAlsAkAtAAAAAA           
RICH_[P]:                                     PPaaPaaPakePkaPgaaPPP                        
RICH_fLPS_[P]:                                PPaaPaaPakePkaPgaaPPP                        
RICH_fLPS_[A]:                                  AApAApAkepkApgAApppAlsAkAtAAAAAA           
RICH_fLPS_[AP]:                               PPAAPAAPAkePkAPgAAPPPAlsAkAtAAAAAA           
RICH_MOBI_[AP]:                                  APAAPAkePkAPgAAPPPA                       
RICH_MOBI_[A]:                                   ApAApAkepkApgAApppA                       
RICH_MOBI_[P]:                                    PaaPakePkaPgaaPPP                        
RICH_fLPS_MOBI_[A]:                              ApAApAkepkApgAApppAl