Q6NXT2 H3C_HUMAN
Gene name: H3-5
Protein name: Histone H3.3C
List of terms from Generic GO subset, which this protein is a part of:
- growth GO:0040007
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BWS9 | CHID1 | 0.84567 | carbohydrate metabolic process GO:0005975 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | Q5TEC6 | H3-2 | 0.84167 | |
| 3 | P47897 | QARS1 | 0.78979 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | Q12798 | CETN1 | 0.77895 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 5 | O94903 | PLPBP | 0.75877 | |
| 6 | P58550 | FXYD6P3 | 0.74566 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | B7Z8K6 | TRDC | 0.73721 | immune system process GO:0002376 membrane organization GO:0061024 response to stress GO:0006950 ... |
| 8 | Q16695 | H3-4 | 0.73682 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 9 | O60869 | EDF1 | 0.73612 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q4W5G0 | TIGD2 | 0.72764 |
20 40 60 80 100 AA: MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYL STMI: DO_DISOPRED3: D......D......DDDDDDDDDDDDDDDDD...D................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DD.................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS_MOBI: D..............DDDDDDDDDDDDDDDDDDDDDD............................................................... RICH_[AK]: ArKstggKAprKqlAtKAArK RICH_[K]: KqtarKstggKaprKqlatKaarK RICH_[T]: TkqTarksTggkaprkqlaT RICH_[KT]: TKqTarKsTggKaprKqlaT RICH_MOBI_[AK]: KqlAtKAArK RICH_MOBI_[K]: KqlatKaarKstpstcgvK
120 AA: VGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA STMI: DO_DISOPRED3: ..................................D DO_IUPRED2A: ................................... DO_SPOTD: ...............................DDDD CONSENSUS: ..................................D CONSENSUS_MOBI: ..................................D