Q5VUE5 CA053_HUMAN

Gene name: C1orf53
Protein name: Uncharacterized protein C1orf53

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P31271 HOXA13 0.74093 anatomical structure development GO:0048856
2 Q9NQX7 ITM2C 0.73727 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
3 Q7RTV5 PRXL2C 0.73333 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
4 P16260 SLC25A16 0.71624 transport GO:0006810
5 Q8NH09 OR8S1 0.69364 signal transduction GO:0007165
6 Q8NBI6 XXYLT1 0.69232 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
7 Q5VZF2 MBNL2 0.6859 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
8 Q99581 FEV 0.68263 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 P22695 UQCRC2 0.68201 generation of precursor metabolites and energy GO:0006091
protein maturation GO:0051604
protein targeting GO:0006605
...
10 Q8N2G6 ZCCHC24 0.67768

                                           20                  40                  60                  80                 100
AA:                      MAARQIWARTGAALCRQPSAAPPPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVSEELTAAERQIAELHAAACAAGQLNYVDPATG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD...D.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
DO_IUPRED2A:             .........................D.......................DDDDDDDDDDDDDDDDDDDDDD.............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AP]:                      ArtgAAlcrqPsAAPPPAP                                                                          
RICH_[A]:                 AArqiwArtgAAlcrqpsAA                                                                               
RICH_[CG]:                                                        CpaneGnCGGsapstpG                                          
RICH_[CP]:                                                        CPanegnCggsaPstPgrP                                        
RICH_[GP]:                                                         PaneGncGGsaPstPGrP                                        
RICH_fLPS_[A]:            AArqiwArtgAAlcrqpsAA                                                                               

                                          120                 140               
AA:                      YVVLTQIAHLQRGECCGSACRHCPYGQVNVKDPSKKKQFNSYFYV
STMI:                                                                 
DO_DISOPRED3:            .............................................
DO_IUPRED2A:             .............................................
DO_SPOTD:                .........................DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .............................................
CONSENSUS_MOBI:          .............................................