Q5VXD3 SAM13_HUMAN
Gene name: SAMD13
Protein name: Sterile alpha motif domain-containing protein 13
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5W0Z9 | ZDHHC20 | 0.63235 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 protein targeting GO:0006605 ... |
| 2 | P25105 | PTAFR | 0.62994 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell adhesion GO:0007155 ... |
| 3 | Q9Y371 | SH3GLB1 | 0.62529 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 4 | Q5TAH2 | SLC9C2 | 0.62272 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | P48039 | MTNR1A | 0.58969 | reproduction GO:0000003 signal transduction GO:0007165 |
| 6 | Q9ULI1 | NWD2 | 0.57735 | |
| 7 | Q8TAB7 | CCDC26 | 0.57735 | |
| 8 | Q8NAB2 | KBTBD3 | 0.57735 | |
| 9 | Q9BXU0 | TEX12 | 0.53254 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 10 | P18075 | BMP7 | 0.5164 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MANSLLEGVFAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... DO_IUPRED2A: ....................DDDDD....DDDDDDDDDDDDDDDDDDD.................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[N]: NkeNgsvgvkNsmeN RICH_[MN]: MeNkeNgsvgvkNsM RICH_[NV]: VdmeNkeNgsVgVkN
120 AA: ALKIYEYHVKPLQTKHLKNNSS STMI: DO_DISOPRED3: ................DDDDDD DO_IUPRED2A: ...............DDDDDDD DO_SPOTD: .............DDDDDDDDD CONSENSUS: ...............DDDDDDD CONSENSUS_MOBI: ......................