Q68J44 DUS29_HUMAN
Gene name: DUSP29
Protein name: Dual specificity phosphatase 29
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15035 | TRAM2 | 0.76792 | biosynthetic process GO:0009058 membrane organization GO:0061024 protein targeting GO:0006605 ... |
| 2 | Q8WV22 | NSMCE1 | 0.68636 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 ... |
| 3 | Q6ZNX1 | SHLD3 | 0.68625 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 4 | Q3ZM63 | ETDA | 0.68617 | |
| 5 | A0A1B0GVM5 | ETDC | 0.68606 | |
| 6 | Q96P63 | SERPINB12 | 0.68542 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 7 | Q5JX71 | FAM209A | 0.68353 | |
| 8 | O95057 | DIRAS1 | 0.68293 | signal transduction GO:0007165 |
| 9 | Q9HAN9 | NMNAT1 | 0.68266 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q4W5G0 | TIGD2 | 0.67944 |
20 40 60 80 100 AA: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDY STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: .DD.............DDDDDDDDDDDDDDDDD................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... RICH_[K]: KtslKnayssaKrlspK RICH_[EY]: YssakrlspkmEEEgEEEdY RICH_fLPS_[E]: pkmEEEgEEE RICH_MOBI_[K]: KtslKnayssaKrlspK
120 140 160 180 200 AA: YRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................