Q6GMV1 ALG1L_HUMAN
Gene name: ALG1L
Protein name: Putative glycosyltransferase ALG1-like
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZQT0 | n/a | 0.848 | |
| 2 | Q99679 | GPR21 | 0.59992 | growth GO:0040007 homeostatic process GO:0042592 signal transduction GO:0007165 |
| 3 | P78385 | KRT83 | 0.59963 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 4 | Q8NGS6 | OR13C3 | 0.54378 | |
| 5 | Q9NVT9 | ARMC1 | 0.53 | transport GO:0006810 |
| 6 | P83859 | QRFP | 0.53 | circulatory system process GO:0003013 signal transduction GO:0007165 |
| 7 | Q9NPL8 | TIMMDC1 | 0.41537 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 8 | P28566 | HTR1E | 0.41082 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 9 | Q96IP4 | TENT5A | 0.38847 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
| 10 | Q05481 | ZNF91 | 0.38746 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 |
20 40 60 80 100 AA: MERSAFMELDAGSRLVMHLREWPALLVSSTGWTEFEQLTLDGHNLPSLVCVITGSVDLGVCLHMSSSGLDLPMKVVDMFGCCLPVCAVNFKCLHELVKHE STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: ENGLVFEDSEELAALQMLFSNFPDPAGKLNQFWKNLRESQQLRWDESWVQTVLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF STMI: DO_DISOPRED3: .....................................................................DD..DDDDDDDDDDDDDD DO_IUPRED2A: ....................................................................................... DO_SPOTD: ..................................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................................................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................................... RICH_[F]: FFsesqgkpF RICH_[CF]: CCpsrsFFsesqgkpF