Q6P5S7 RNK_HUMAN
Gene name: RNASEK
Protein name: Ribonuclease kappa
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P15621 | ZNF44 | 0.72363 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | P04818 | TYMS | 0.6953 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 3 | Q8TEF2 | C10orf105 | 0.68153 | |
| 4 | O15235 | MRPS12 | 0.67826 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 5 | Q2M3D2 | EXOC3L2 | 0.67786 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 6 | P04053 | DNTT | 0.67653 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 7 | P42679 | MATK | 0.67626 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 8 | Q8NCU8 | MTLN | 0.67411 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 |
| 9 | A8MX76 | CAPN14 | 0.67309 | |
| 10 | Q86VU5 | COMTD1 | 0.66534 |
20 40 60 80 100 AA: MGWLRPGPRPLCPPARASWAFSHRFPSPLAPRRSPTPFFMASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNL STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... ............................ CONSENSUS_MOBI: ................................................... ............................ RICH_[PR]: RPgPRPlcPPaRaswafshR RICH_[PW]: WlrPgPrPlcPParasW RICH_[AP]: PPArAswAfshrfPsPlAP RICH_[R]: RpgpRplcppaRaswafshR RICH_[W]: WlrpgprplcpparasW
120 AA: YEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................................DDD DO_IUPRED2A: ..................................... DO_SPOTD: .............................DDDDDDDD CONSENSUS: ... ..........DDD CONSENSUS_MOBI: ... .............