Q6PI98 IN80C_HUMAN

Gene name: INO80C
Protein name: INO80 complex subunit C

List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z569 BRAP 0.56597 cellular protein modification process GO:0006464
signal transduction GO:0007165
2 Q9H2S1 KCNN2 0.53826 cell-cell signaling GO:0007267
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
3 Q9UBF6 RNF7 0.49904 catabolic process GO:0009056
cellular protein modification process GO:0006464
4 P15814 IGLL1 0.4899 immune system process GO:0002376
membrane organization GO:0061024
response to stress GO:0006950
...
5 Q6DCA0 AMMECR1L 0.4892
6 Q9H3M0 KCNF1 0.48474 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
transmembrane transport GO:0055085
...
7 Q9Y237 PIN4 0.48167 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
8 Q9UPE1 SRPK3 0.48166 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
9 Q5VVW2 GARNL3 0.47541 signal transduction GO:0007165
10 O76031 CLPX 0.47051 catabolic process GO:0009056
protein folding GO:0006457

                                           20                  40                  60                  80                 100
AA:                      MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DD..............
DO_IUPRED2A:             ...DD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D.DDDD....D..DDD.DDDDDDDD..DDD..DDDDDDD.....DDDDDD.DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
RICH_[AG]:                                                GGGyGAskkkkAsAssfAqG                                               
RICH_[AK]:                                                     AsKKKKAsAssfAqgismeA                                          
RICH_[AS]:                                              SSgggygASkkkkASASSfA                                                 
RICH_[I]:                    IpIvattstpgI                                                                                    
RICH_[S]:                                               SSgggygaSkkkkaSaSS                                                   
RICH_[GK]:                                             GssGGGyGasKKKKasassfaqG                                               
RICH_[GS]:                                        SpShnGSSGGGyGaSkkkkaSaSS                                                   
RICH_[KS]:                                              SSgggygaSKKKKaSaSS                                                   
RICH_fLPS_[G]:                                       hnGssGGGyG                                                              
RICH_fLPS_[M]:                                                                 sMeaMsenkM                                    
RICH_MOBI_[I]:               IpIvattstpgI                                                                                    
RICH_MOBI_[TV]:                 VaTTsTpgiV                                                                                   
RICH_MOBI_[GK]:                                        GssGGGyGasKKKK                                                        
RICH_MOBI_[GS]:                                   SpShnGSSGGGyGaS                                                            
RICH_fLPS_MOBI_[G]:                                  hnGssGGGyG                                                              

                                          120                 140                 160                 180        
AA:                      KNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP
STMI:                                                                                                                
DO_DISOPRED3:            ............................................................................................
DO_IUPRED2A:             D...........................................................................................
DO_SPOTD:                DDD.........................................................................................
CONSENSUS:               D...........................................................................................
CONSENSUS_MOBI:          ............................................................................................