Q6PK57 DMP34_HUMAN

Gene name: DNM1P34
Protein name: Putative GED domain-containing protein DNM1P34

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q53H54 TRMT12 0.70711 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q8WU49 C7orf33 0.67267
3 Q8N988 ZNF557 0.62862
4 Q5VXD3 SAMD13 0.57735 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q9BXU0 TEX12 0.52135 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
6 P41208 CETN2 0.45222 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
7 Q99873 PRMT1 0.43853 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 Q8N8Q9 NIPA2 0.42927 transport GO:0006810
9 Q8WWB3 DYDC1 0.42465 cellular protein modification process GO:0006464
chromosome organization GO:0051276
10 O95397 PLEKHA8P1 0.41574 membrane organization GO:0061024
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MPSCSPQQASKAEENGSNSFMHSMVPQLEWQMETTQSLVDSYVAIVNKTVWDLMVGLTPKTIMHLMINNNKEFIFSELLANLYLHGDKNMLMEESAEQAQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDD..........................................................................DDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDD...................................................................DDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD....................................................................DDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[MN]:                             NgsNsfMhsM                                                                            

                                           
AA:                      RS
STMI:                      
DO_DISOPRED3:            DD
DO_IUPRED2A:             DD
DO_SPOTD:                DD
CONSENSUS:               DD
CONSENSUS_MOBI:          ..