Q6Q6R5 CRIP3_HUMAN
Gene name: CRIP3
Protein name: Cysteine-rich protein 3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y4U1 | MMACHC | 0.98853 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 2 | A6NKQ9 | CGB1 | 0.89283 | signal transduction GO:0007165 |
| 3 | Q9P0T4 | ZNF581 | 0.88772 | |
| 4 | Q8TEE9 | SAP25 | 0.86815 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q96QK8 | SMIM14 | 0.86193 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 6 | Q16613 | AANAT | 0.86142 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 7 | A0PG75 | PLSCR5 | 0.86053 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 8 | Q14626 | IL11RA | 0.8581 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 9 | P50281 | MMP14 | 0.85221 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 10 | O75880 | SCO1 | 0.85045 | catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
20 40 60 80 100 AA: MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRP STMI: DO_DISOPRED3: D.........................................................................................DDDDDDDDDD DO_IUPRED2A: .......................................................................................DDDDDD...DDDD DO_SPOTD: DD..............................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: D......................................................................................DDDDDDDDDDDDD CONSENSUS_MOBI: ...................................................................................DDDDDDDDDDDDDDDDD RICH_[PS]: PlSPSSfSPP RICH_[P]: PlsPssfsPPrP RICH_MOBI_[PS]: PlSPSSfSPP RICH_MOBI_[P]: PgcttPlsPssfsPPrP
120 140 160 180 200 AA: RTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGGQPHPRHWDGMYMPE STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD................................................................................DDDD DO_IUPRED2A: DDDDDDDDDDDDD....................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDD.D.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDD........................................................................................ RICH_[P]: rtglP
AA: VWHVHGLWVCVDNFPCG STMI: DO_DISOPRED3: DDDDDDDDDDDDDD.DD DO_IUPRED2A: ................. DO_SPOTD: ...............DD CONSENSUS: ...............DD CONSENSUS_MOBI: .................