Q16613 SNAT_HUMAN
Gene name: AANAT
Protein name: Serotonin N-acetyltransferase
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- protein maturation GO:0051604
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0PG75 | PLSCR5 | 0.99974 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 2 | Q96QK8 | SMIM14 | 0.99941 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 3 | P60606 | CTXN1 | 0.99941 | |
| 4 | P50281 | MMP14 | 0.99329 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 5 | Q14626 | IL11RA | 0.99172 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 6 | O75880 | SCO1 | 0.9917 | catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 7 | Q8IY18 | SMC5 | 0.99064 | cell cycle GO:0007049 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q9BQI0 | AIF1L | 0.95512 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 9 | Q9Y4U1 | MMACHC | 0.92823 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 10 | O75871 | CEACAM4 | 0.91617 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
20 40 60 80 100 AA: MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_[P]: PlkPeaPrlPPgiPesP RICH_MOBI_[P]: PlkPeaPrlPPgiPesP
120 140 160 180 200 AA: KERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCAITVGSLTFMELHCSLRGHPF STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: LRRNSGC STMI: DO_DISOPRED3: ...DDDD DO_IUPRED2A: ....... DO_SPOTD: ..DDDD. CONSENSUS: ...DDD. CONSENSUS_MOBI: .......