Q96QK8 SIM14_HUMAN

Gene name: SMIM14
Protein name: Small integral membrane protein 14

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- embryo development GO:0009790

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96QK8 SMIM14 1 anatomical structure development GO:0048856
embryo development GO:0009790
2 Q16613 AANAT 0.99941 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 A0PG75 PLSCR5 0.99837 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810
4 Q14626 IL11RA 0.99555 anatomical structure development GO:0048856
cell population proliferation GO:0008283
signal transduction GO:0007165
5 P50281 MMP14 0.98872 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
6 O75880 SCO1 0.98668 catabolic process GO:0009056
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
7 Q8IY18 SMC5 0.98535 cell cycle GO:0007049
cell division GO:0051301
cellular nitrogen compound metabolic process GO:0034641
...
8 Q9BQI0 AIF1L 0.96476 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
9 Q9Y4U1 MMACHC 0.92842 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
10 O75871 CEACAM4 0.91521 transport GO:0006810
vesicle-mediated transport GO:0016192

                                           20                  40                  60                  80 
AA:                      MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD
STMI:                                                                     MMMMMMMMMMMMMMMMMMMMM                             
DO_DISOPRED3:            DDDD...........................................................................DDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...........................................DD................................DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD.......................................DD....                     .......DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................................................                     .......DDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                                                                                PgkPtsPhngqdPPaPP  
RICH_MOBI_[P]:                                                                                           PgkPtsPhngqdPPaPP