Q96QK8 SIM14_HUMAN
Gene name: SMIM14
Protein name: Small integral membrane protein 14
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- embryo development GO:0009790
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q96QK8 | SMIM14 | 1 |
anatomical structure development
GO:0048856 embryo development GO:0009790 |
2 | Q16613 | AANAT | 0.99941 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
3 | A0PG75 | PLSCR5 | 0.99837 |
membrane organization
GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
4 | Q14626 | IL11RA | 0.99555 |
anatomical structure development
GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
5 | P50281 | MMP14 | 0.98872 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
6 | O75880 | SCO1 | 0.98668 |
catabolic process
GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
7 | Q8IY18 | SMC5 | 0.98535 |
cell cycle
GO:0007049 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 ... |
8 | Q9BQI0 | AIF1L | 0.96476 |
cellular component assembly
GO:0022607 cytoskeleton organization GO:0007010 |
9 | Q9Y4U1 | MMACHC | 0.92842 |
cellular nitrogen compound metabolic process
GO:0034641 small molecule metabolic process GO:0044281 |
10 | O75871 | CEACAM4 | 0.91521 |
transport
GO:0006810 vesicle-mediated transport GO:0016192 |
20 40 60 80
AA: MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD
STMI: MMMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3: DDDD...........................................................................DDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A: ...........................................DD................................DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD: DDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS: DDDD.......................................DD.... .......DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ................................................. .......DDDDDDDDDDDDDDDDDDDDDD
RICH_[P]: PgkPtsPhngqdPPaPP
RICH_MOBI_[P]: PgkPtsPhngqdPPaPP