Q6QNY1 BL1S2_HUMAN
Gene name: BLOC1S2
Protein name: Biogenesis of lysosome-related organelles complex 1 subunit 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cytoskeleton organization GO:0007010
- cytoskeleton-dependent intracellular transport GO:0030705
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96S44 | TP53RK | 0.9847 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 2 | Q9BSY9 | DESI2 | 0.95271 | cellular protein modification process GO:0006464 |
| 3 | Q8MH63 | SLC7A5P1 | 0.93407 | |
| 4 | Q9Y235 | APOBEC2 | 0.91798 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 mRNA processing GO:0006397 |
| 5 | Q9BV29 | CCDC32 | 0.91248 | |
| 6 | O43930 | PRKY | 0.90088 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q99536 | VAT1 | 0.88955 | anatomical structure development GO:0048856 immune system process GO:0002376 transport GO:0006810 ... |
| 8 | P29966 | MARCKS | 0.88597 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 9 | Q01650 | SLC7A5 | 0.8584 | circulatory system process GO:0003013 immune system process GO:0002376 transmembrane transport GO:0055085 ... |
| 10 | Q96BN8 | OTULIN | 0.85055 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: ........DDDDDDDDDDDDDDDDDDDDDD.DDD.................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... RICH_[AE]: AtrsdEpArddAAvEtAEEAkEpAE RICH_[A]: AAAAegvlAtrsdepArddAAvetAeeAkepA RICH_[E]: EparddaavEtaEEakEpaE RICH_fLPS_[A]: mAAAAegvlAtrsdepArddAA RICH_MOBI_[AE]: AtrsdEpArddAAvEtAEEAkEpA RICH_MOBI_[A]: AAAAegvlAtrsdepArddAAvetA RICH_fLPS_MOBI_[A]: mAAAAegvlAtrsdepArddAA
120 140 AA: LQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR STMI: DO_DISOPRED3: .........................................D DO_IUPRED2A: .......................................... DO_SPOTD: .....................................DDDDD CONSENSUS: .........................................D CONSENSUS_MOBI: ..........................................