Q9BSY9 DESI2_HUMAN
Gene name: DESI2
Protein name: Deubiquitinase DESI2
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96S44 | TP53RK | 0.98919 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 2 | Q9BV29 | CCDC32 | 0.97498 | |
| 3 | Q9Y235 | APOBEC2 | 0.96193 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 mRNA processing GO:0006397 |
| 4 | Q6QNY1 | BLOC1S2 | 0.95271 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 5 | Q8MH63 | SLC7A5P1 | 0.93073 | |
| 6 | O43930 | PRKY | 0.88872 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | P29966 | MARCKS | 0.86848 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 8 | Q01650 | SLC7A5 | 0.86398 | circulatory system process GO:0003013 immune system process GO:0002376 transmembrane transport GO:0055085 ... |
| 9 | Q99536 | VAT1 | 0.84998 | anatomical structure development GO:0048856 immune system process GO:0002376 transport GO:0006810 ... |
| 10 | Q96L14 | CEP170P1 | 0.84086 |
20 40 60 80 100 AA: MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNA STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: YHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL STMI: DO_DISOPRED3: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ............................................................DD...DDD.........DDDDDD....D.DDDDD DO_SPOTD: ...................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[AE]: ElqdElEEAEdAAAsAsvAstAA RICH_[A]: AedAAAsAsvAstAA RICH_[E]: ElqdElEEaE RICH_fLPS_[A]: deleeAedAAAsAsvAstAA RICH_MOBI_[AE]: ElEEAEdAAAsAsvAstAA RICH_MOBI_[A]: AedAAAsAsvAstAA RICH_fLPS_MOBI_[A]: deleeAedAAAsAsvAstAA