Q6UWF3 SCIMP_HUMAN

Gene name: SCIMP
Protein name: SLP adapter and CSK-interacting membrane protein

List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IY18 SMC5 0.88445 cell cycle GO:0007049
cell division GO:0051301
cellular nitrogen compound metabolic process GO:0034641
...
2 O75880 SCO1 0.88412 catabolic process GO:0009056
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
3 P50281 MMP14 0.88347 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
4 A0PG75 PLSCR5 0.87444 membrane organization GO:0061024
plasma membrane organization GO:0007009
transport GO:0006810
5 Q16613 AANAT 0.87111 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 O77932 DXO 0.86643 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
nucleobase-containing compound catabolic process GO:0034655
7 Q96QK8 SMIM14 0.86516 anatomical structure development GO:0048856
embryo development GO:0009790
8 Q14626 IL11RA 0.84367 anatomical structure development GO:0048856
cell population proliferation GO:0008283
signal transduction GO:0007165
9 Q9UND3 NPIPA1 0.84106 protein transport GO:0015031
transport GO:0006810
10 P46098 HTR3A 0.83369 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...

                                           20                  40                  60                  80                 100
AA:                      MDTFTVQDSTAMSWWRNNFWIILAVAIIVVSVGLGLILYCVCKWQLRRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAP
STMI:                                      MMMMMMMMMMMMMMMMMMMMM                                                             
DO_DISOPRED3:            DDDDDDD........................................................................................DD...
DO_IUPRED2A:             ...............................................................................D...DDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDD......................................DDDDD.D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDD...........                     ........................................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................                     ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                                                                                PPlPPrnwPsledssPqeaP
RICH_MOBI_[P]:                                                                                       PvqlPPlPPrnwPsledssPqeaP
RICH_MOBI_[LP]:                                                                                      PvqLPPLPPrnwPsL         

                                          120                 140               
AA:                      SQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTEKASF
STMI:                                                                 
DO_DISOPRED3:            ..................................DDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDD......................DDDDDDDDDD.DD.D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDD......................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDD......................................