Q6UWT2 ENHO_HUMAN

Gene name: ENHO
Protein name: Adropin

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P11279 LAMP1 0.90392 cell death GO:0008219
cytoskeleton-dependent intracellular transport GO:0030705
immune system process GO:0002376
...
2 P04180 LCAT 0.85239 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
3 A0A1B0GUX0 ATP6V1FNB 0.85113
4 Q5BKX5 C19orf54 0.85087
5 Q6NT52 CGB2 0.83281 signal transduction GO:0007165
6 Q9Y6J3 SMAD5-AS1 0.82047 signal transduction GO:0007165
7 O43516 WIPF1 0.82003 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
8 Q6ZMJ4 IL34 0.8185 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
9 Q9Y6U7 RNF215 0.80593 catabolic process GO:0009056
response to stress GO:0006950
10 Q9NPA2 MMP25 0.80545 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...

                                           20                  40                  60    
AA:                      MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                           
DO_DISOPRED3:            DDDDD..............................................DDDDDDDDDDDDDDDDDDDDDD.DD
DO_IUPRED2A:             ...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
DO_SPOTD:                DDDDDDD...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                                ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                           .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                                                PnssPgPcPekaPPPqkP          
RICH_fLPS_[P]:                                                         ssPnssPgPcPekaPPPqkP          
RICH_MOBI_[PS]:                                                    SlSeSSPnSSPgPcPekaPP              
RICH_MOBI_[P]:                                                           PnssPgPcPekaPPPqkP          
RICH_MOBI_[S]:                                                     SlSeSSpnSS                        
RICH_fLPS_MOBI_[P]:                                                         sPgPcPekaPPPqkP