Q9Y6J3 SMA5O_HUMAN

Gene name: SMAD5-AS1
Protein name: SMAD5 antisense gene protein 1

List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BTD3 TMEM121 0.94281
2 Q9Y6U7 RNF215 0.90919 catabolic process GO:0009056
response to stress GO:0006950
3 P20809 IL11 0.90833 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q9NPA2 MMP25 0.89388 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
5 A0A1B0GUX0 ATP6V1FNB 0.88076
6 P23396 RPS3 0.87615 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 P0C7Q6 SLC35G6 0.87471
8 O43516 WIPF1 0.86746 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
9 A0A0U1RRE5 NBDY 0.85242 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 Q15428 SF3A2 0.84813 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80     
AA:                      MHKQPKLLPPPATPPPPPQSSSWSGNIVFTIKINIWLRVFSHSSPTGLPKPHSPMPSPPEPEHSVGKPANVQIPQVSSPEFCNQKSVLATEHAQT
STMI:                                                                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD..........................................................................DDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
RICH_[P]:                    PkllPPPatPPPPP                          PtglPkPhsPmPsPPePehsvgkPanvqiP                     
RICH_[HP]:                                                               PkPHsPmPsPPePeH                                
RICH_fLPS_[P]:           mhkqPkllPPPatPPPPPqs                                                                           
RICH_MOBI_[PS]:                        PPPPqSSSwS                                                                       
RICH_MOBI_[P]:               PkllPPPatPPPPP                          PtglPkPhsPmPsPPePehsvgkP                           
RICH_MOBI_[HP]:                                                          PkPHsPmPsPPePeH                                
RICH_fLPS_MOBI_[P]:      mhkqPkllPPPatPPPPPqs