Q9H4E5 RHOJ_HUMAN
Gene name: RHOJ
Protein name: Rho-related GTP-binding protein RhoJ
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell morphogenesis GO:0000902
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXN8 | CLEC9A | 0.88001 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 2 | Q9HBK9 | AS3MT | 0.87054 | small molecule metabolic process GO:0044281 |
| 3 | Q96GX9 | APIP | 0.784 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 4 | P60409 | KRTAP10-7 | 0.76944 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 5 | Q9NYP9 | MIS18A | 0.76339 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 6 | Q14525 | KRT33B | 0.76294 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 7 | O76011 | KRT34 | 0.7389 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 8 | P60371 | KRTAP10-6 | 0.72273 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | P60411 | KRTAP10-9 | 0.7108 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | P60368 | KRTAP10-2 | 0.7108 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[C]: CkegtdssCgC RICH_[CG]: GtdssCGCrG RICH_fLPS_[C]: mnCkegtdssCgCrg
120 140 160 180 200 AA: SVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKK STMI: DO_DISOPRED3: ..................................................................................................DD DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..................................................................................................DD CONSENSUS: ..................................................................................................DD CONSENSUS_MOBI: ....................................................................................................
AA: KKRCSEGHSCCSII STMI: DO_DISOPRED3: DDDDDDDDD..... DO_IUPRED2A: .............. DO_SPOTD: DDDDDDDDDD.DDD CONSENSUS: DDDDDDDDD..... CONSENSUS_MOBI: ..............