A0A1B0GUC4 MYCOS_HUMAN

Gene name: MYOCOS
Protein name: Myocilin opposite strand protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P20809 IL11 0.92894 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 O00445 SYT5 0.91597 cell-cell signaling GO:0007267
transport GO:0006810
vesicle-mediated transport GO:0016192
3 Q86XT4 TRIM50 0.90543 cellular protein modification process GO:0006464
4 Q7Z7M8 B3GNT8 0.90528 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
5 A0A1B0GUX0 ATP6V1FNB 0.9006
6 Q9Y6U7 RNF215 0.89898 catabolic process GO:0009056
response to stress GO:0006950
7 Q15390 MTFR1 0.88805 generation of precursor metabolites and energy GO:0006091
8 P23396 RPS3 0.88183 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q9UM63 PLAGL1 0.87851 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
10 Q86XR5 PRIMA1 0.87174 catabolic process GO:0009056

                                           20                  40                  60                  80                 100
AA:                      MAQKSLANNSINLPYKDLTSEVTRRRVTMITRKEIITQKSDEAKEMLSHLDLEQAPPPHRTYLTVPPAPPPSPAEDPTPDGLSFKIREAGTSVSSDFSSW
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDD........................................................D..............................
DO_IUPRED2A:             DDDD..D..DDDDDDDDDD..D.D....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........DD........
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS_MOBI:          ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
RICH_[P]:                                                                       PPPhrtyltvPPaPPPsPaedPtP                     
RICH_[LP]:                                                             LshLdLeqaPPPhrtyLtvP                                  
RICH_fLPS_[P]:                                                                  PPPhrtyltvPPaPPPsPaedPtP                     
RICH_MOBI_[P]:                                                                  PPPhrtyltvPPaPPPsPaedPtP                     
RICH_fLPS_MOBI_[P]:                                                             PPPhrtyltvPPaPPPsPaedPtP                     

                                     
AA:                      KAKVSKFH
STMI:                            
DO_DISOPRED3:            .......D
DO_IUPRED2A:             ........
DO_SPOTD:                ..DDDDDD
CONSENSUS:               .......D
CONSENSUS_MOBI:          ........