Q6ZRF7 ZN818_HUMAN
Gene name: ZNF818P
Protein name: Putative zinc finger protein 818
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q13003 | GRIK3 | 1 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 2 | Q7L775 | EPM2AIP1 | 1 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 generation of precursor metabolites and energy GO:0006091 ... |
| 3 | Q9UNH6 | SNX7 | 0.89319 | protein transport GO:0015031 transport GO:0006810 |
| 4 | Q15262 | PTPRK | 0.8155 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 5 | Q8TBF8 | FAM81A | 0.77353 | |
| 6 | O75469 | NR1I2 | 0.75364 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 7 | Q8N112 | LSMEM2 | 0.70711 | |
| 8 | Q9BUE0 | MED18 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q9P104 | DOK5 | 0.65903 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | Q8NET4 | RTL9 | 0.64834 |
20 40 60 80 100 AA: MLERNLTSMMSVEEPLPRPLTSLYIRLSILERNHMNMTYMAKSSVKIHISKVIIGFVLKRSLTNVCGKVLSQNSHLVNHQRIHTGEKSYRCHECGKAFTQ STMI: DO_DISOPRED3: DDDDDD.DDD.........D................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDD.D........................................... CONSENSUS: DDDDDDDDDD.........D................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[M]: MlernltsMM RICH_fLPS_[M]: MlernltsMM
120 AA: GSRFINHQIVHTGENFPNVLNVARLLRMALNSGLTK STMI: DO_DISOPRED3: ...................................D DO_IUPRED2A: .................................... DO_SPOTD: .............................DDDDDDD CONSENSUS: ...................................D CONSENSUS_MOBI: ....................................