Q6ZRY4 RBPS2_HUMAN
Gene name: RBPMS2
Protein name: RNA-binding protein with multiple splicing 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- embryo development GO:0009790
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P575 | GUSBP11 | 0.99358 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 2 | Q8IV45 | UNC5CL | 0.99344 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 3 | O96011 | PEX11B | 0.98825 | signal transduction GO:0007165 |
| 4 | Q9Y5Y6 | ST14 | 0.98233 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 5 | Q8TDH9 | BLOC1S5 | 0.97616 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 6 | Q6XUX3 | DSTYK | 0.96871 | cell death GO:0008219 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q96CM4 | NXNL1 | 0.96746 | homeostatic process GO:0042592 |
| 8 | P17342 | NPR3 | 0.96302 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 circulatory system process GO:0003013 ... |
| 9 | Q8WW01 | TSEN15 | 0.9377 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 10 | Q9UKL4 | GJD2 | 0.9321 | cell-cell signaling GO:0007267 nervous system process GO:0050877 |
20 40 60 80 100 AA: MSNLKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTARQPVGFVIFDSRAGAEAAKNALNGIRFDPENPQT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDD...............................................................DDD.D........ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ RICH_[G]: GehGGstGtGsGaGsGG RICH_fLPS_[G]: kpdGehGGstGtGsGaGsGG RICH_MOBI_[G]: GehGGstGtGsGaGsGG RICH_fLPS_MOBI_[G]: kpdGehGGstGtGsGaGsGG
120 140 160 180 200 AA: LRLEFAKANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQ STMI: DO_DISOPRED3: ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...DDD.........DDDD................................................................................. DO_SPOTD: ...........DDDDDDDDDDDDDDD.......................................................................... CONSENSUS: ...........DDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: QGWKYRQFC STMI: DO_DISOPRED3: .D....... DO_IUPRED2A: ......... DO_SPOTD: ......... CONSENSUS: ......... CONSENSUS_MOBI: .........