Q8TDH9 BL1S5_HUMAN
Gene name: BLOC1S5
Protein name: Biogenesis of lysosome-related organelles complex 1 subunit 5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cytoskeleton-dependent intracellular transport GO:0030705
- developmental maturation GO:0021700
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96CM4 | NXNL1 | 0.99931 | homeostatic process GO:0042592 |
| 2 | Q9Y5Y6 | ST14 | 0.99907 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 3 | O96011 | PEX11B | 0.997 | signal transduction GO:0007165 |
| 4 | P17342 | NPR3 | 0.99645 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 circulatory system process GO:0003013 ... |
| 5 | Q6P575 | GUSBP11 | 0.98483 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 6 | Q8WW01 | TSEN15 | 0.97843 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 7 | Q6ZRY4 | RBPMS2 | 0.97616 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 8 | O14508 | SOCS2 | 0.97549 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | Q8IV45 | UNC5CL | 0.94804 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 10 | P0DMV9 | HSPA1B | 0.9219 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DD.......................D..DDDDDDDDDDDDDDDDDDDDDDDD.. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... RICH_[G]: GGGtetpvGceaapGGG RICH_fLPS_[G]: msGGGtetpvGceaapGGGs RICH_MOBI_[G]: GGGtetpvGceaapGGG RICH_fLPS_MOBI_[G]: msGGGtetpvGceaapGGGs
120 140 160 180 AA: SLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF STMI: DO_DISOPRED3: ....................................................................................... DO_IUPRED2A: .D..DD.........DDD.DDDDD..DDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. DO_SPOTD: ..................................................................................DDDDD CONSENSUS: ....................................................................................... CONSENSUS_MOBI: .......................................................................................