Q8WW01 SEN15_HUMAN
Gene name: TSEN15
Protein name: tRNA-splicing endonuclease subunit Sen15
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14508 | SOCS2 | 0.98613 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 2 | Q96CM4 | NXNL1 | 0.98073 |
homeostatic process
GO:0042592 |
| 3 | Q9Y5Y6 | ST14 | 0.98026 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 4 | P17342 | NPR3 | 0.97972 |
anatomical structure development
GO:0048856 cell population proliferation GO:0008283 circulatory system process GO:0003013 ... |
| 5 | Q8TDH9 | BLOC1S5 | 0.97843 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 6 | O96011 | PEX11B | 0.97483 |
signal transduction
GO:0007165 |
| 7 | Q6P575 | GUSBP11 | 0.94814 |
carbohydrate metabolic process
GO:0005975 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 8 | Q6ZRY4 | RBPMS2 | 0.9377 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 9 | P50895 | BCAM | 0.92839 |
cell adhesion
GO:0007155 signal transduction GO:0007165 |
| 10 | Q8N9U9 | SPANXA2-OT1 | 0.91247 |
cell cycle
GO:0007049 cell death GO:0008219 reproduction GO:0000003 |
20 40 60 80 100
AA: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGE
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................................
DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDD..DDDD...DDDDD................................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
RICH_[G]: GdseptpGcsGlGpGGvrGfGdGGG
RICH_fLPS_[G]: tpGcsGlGpGGvrGfGdGGG
RICH_MOBI_[G]: GdseptpGcsGlGpGGvrGfGdGGG
RICH_fLPS_MOBI_[G]: tpGcsGlGpGGvrGfGdGGG
120 140 160
AA: GLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
STMI:
DO_DISOPRED3: ................................................................DDDDDDD
DO_IUPRED2A: .......D...............................................................
DO_SPOTD: ...............................................................DDDDDDDD
CONSENSUS: ................................................................DDDDDDD
CONSENSUS_MOBI: .......................................................................