Q701N4 KRA52_HUMAN
Gene name: KRTAP5-2
Protein name: Keratin-associated protein 5-2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6L8H2 | KRTAP5-3 | 0.99852 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 2 | Q6L8H4 | KRTAP5-1 | 0.98218 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 3 | Q14533 | KRT81 | 0.89493 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 4 | Q701N2 | KRTAP5-5 | 0.83869 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 5 | Q6L8H1 | KRTAP5-4 | 0.83711 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q6L8G5 | KRTAP5-10 | 0.8056 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | Q5T750 | XP32 | 0.77241 | anatomical structure development GO:0048856 |
| 8 | Q9H4E5 | RHOJ | 0.68693 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 9 | Q9NYP9 | MIS18A | 0.66999 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 10 | Q8IUG1 | KRTAP1-3 | 0.6204 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MGCCGCSRGCGSGCGGCGSSCGGCGSGCGGCGSGRGGCGSGCGGCSSSCGGCGSRCYVPVCCCKPVCSWVPACSCTSCGSCGGSKGGCGSCGGSKGGCGS STMI: DO_DISOPRED3: DD...D.DD...DDDDDDDDDDDDDDDDDDDDDD.DDDDDD....D...................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D...................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[C]: CCgCsrgCgsgCggCgssCggCgsgCggCgsgrggC RICH_[G]: GccGcsrGcGsGcGGcGsscGGcGsGcGGcGsGrGGcGsG RICH_[CG]: GCCGCsrGCGsGCGGCGssCGGCGsGCGGCGsGrGGCGsG RICH_fLPS_[C]: CCgCsrgCgsgCggCgssCggCgsgCggCgsgrggC RICH_fLPS_[CG]: GCCGCsrGCGsGCGGCGssCGGCGsGCGGCGsGrGGCGsG RICH_fLPS_[G]: GcGsGcGGcGsscGGcGsGcGGcGsGrGGcGsG
120 140 160 AA: CGGSKGGCGSCGCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCCQSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI STMI: DO_DISOPRED3: ............................................................................. DO_IUPRED2A: ............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............................................................................. CONSENSUS_MOBI: .............................................................................