Q9NYP9 MS18A_HUMAN
Gene name: MIS18A
Protein name: Protein Mis18-alpha
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- chromosome segregation GO:0007059
- DNA metabolic process GO:0006259
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H4E5 | RHOJ | 0.76339 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 2 | Q701N2 | KRTAP5-5 | 0.73319 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 3 | Q8NGA4 | GPR32P1 | 0.70602 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 4 | Q6L8H1 | KRTAP5-4 | 0.70335 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 5 | Q701N4 | KRTAP5-2 | 0.66999 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q6L8H4 | KRTAP5-1 | 0.66695 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | Q6L8H2 | KRTAP5-3 | 0.66281 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 8 | Q6L8G5 | KRTAP5-10 | 0.64425 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q14533 | KRT81 | 0.61863 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 10 | Q9Y6K0 | CEPT1 | 0.61455 | biosynthetic process GO:0009058 |
20 40 60 80 100 AA: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDDDDDDDD......................... DO_IUPRED2A: ..............................................................D......D.............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............D..DDDDDDDDDDDDDDDDDDDDDD......................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDD......................... CONSENSUS_MOBI: .................................................................................................... RICH_[AE]: EdAsvAdmErAqlEEEAAA RICH_[A]: AsvAdmerAqleeeAAA RICH_[C]: CsrgCaggCeCgdkgkC RICH_[G]: GcaGGcecGdkG RICH_[CG]: GvrslrCsrGCaGGCeCGdkGkCsdssllG RICH_fLPS_[C]: slrCsrgCaggCeCgdkgkC
120 140 160 180 200 AA: SQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: IEKSLTQMEDVLKALQMKLWEAESKLSFATCKS STMI: DO_DISOPRED3: ...........................DDDDDD DO_IUPRED2A: ................................. DO_SPOTD: ........................DDDDDDDDD CONSENSUS: ...........................DDDDDD CONSENSUS_MOBI: .................................