Q9HBE4 IL21_HUMAN
Gene name: IL21
Protein name: Interleukin-21
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92466 | DDB2 | 0.99861 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 2 | Q15388 | TOMM20 | 0.9658 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 3 | P0C843 | LINC00032 | 0.91224 | |
| 4 | P62753 | RPS6 | 0.89909 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q8IZU8 | DSEL | 0.89339 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 6 | Q9NV72 | ZNF701 | 0.86428 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q8WV37 | ZNF480 | 0.86056 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q5T2T1 | MPP7 | 0.85548 | cell junction organization GO:0034330 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 9 | P0DMS9 | TMIGD3 | 0.85499 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P62266 | RPS23 | 0.82263 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKP STMI: SSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD............................................................................... DO_IUPRED2A: .......................D..................................................................DDDDD...DD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.........................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................................................................DDDDDDDDDD CONSENSUS_MOBI: .............................................................................. RICH_[K]: KKlKrKp RICH_[R]: Rkp RICH_[KR]: KKlKRKp
120 140 AA: PSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS STMI: DO_DISOPRED3: ..............................................DDDDDDDDD DO_IUPRED2A: DDDDDDDDDDD.DDDDDD.........................DDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDD...............................DDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDD...............................DDDDDDDDDD CONSENSUS_MOBI: ....................................................... RICH_[K]: pstnagrrqK RICH_[R]: pstnagRRqkhR RICH_[KR]: pstnagRRqKhR