Q7Z6I5 SPT12_HUMAN
Gene name: SPATA12
Protein name: Spermatogenesis-associated protein 12
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N7M0 | TCTEX1D1 | 0.848 | |
| 2 | A6NJI9 | LRRC72 | 0.79262 | |
| 3 | P0C853 | BAALC-AS2 | 0.72032 | |
| 4 | Q9BQC3 | DPH2 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 5 | Q9UHQ4 | BCAP29 | 0.70711 | cell death GO:0008219 cell differentiation GO:0030154 protein transport GO:0015031 ... |
| 6 | O75752 | B3GALNT1 | 0.68394 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 |
| 7 | P26718 | KLRK1 | 0.59136 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | Q9Y5Q6 | INSL5 | 0.57577 | signal transduction GO:0007165 |
| 9 | Q8WXB4 | ZNF606 | 0.57525 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q6ECI4 | ZNF470 | 0.57313 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIAVSQIN STMI: DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: ..................D...DDDD...D.DDDDDDDDDDDD....D................D................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................. CONSENSUS: DDDDDDDDDDD.......DDDDDDDDDDDDDDDDDDDDDDDDD....D................D................................... CONSENSUS_MOBI: .................................................................................................... RICH_[W]: WemkaldssrlvpW
120 140 160 180 AA: LLGRPSSPPALLIQQGSCEQVIHNSTPQFLGMEDGDNERTTGWLWRLCEDIDAEPSSTGCSRSNQLTFTEGCFVRSLSTVYSNTHIHTHL STMI: DO_DISOPRED3: ............................................................D....................D....DDDD DO_IUPRED2A: ............................DDDDDD........................................................ DO_SPOTD: ....................................................DDDDDDDDDDD........................... CONSENSUS: ............................................................D............................. CONSENSUS_MOBI: ..........................................................................................