Q8N7M0 TC1D1_HUMAN
Gene name: TCTEX1D1
Protein name: Tctex1 domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | B4DU55 | ZNF879 | 0.848 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q7Z6I5 | SPATA12 | 0.848 | |
| 3 | A6NJI9 | LRRC72 | 0.67214 | |
| 4 | Q8WXB4 | ZNF606 | 0.66848 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | P0C853 | BAALC-AS2 | 0.61083 | |
| 6 | Q9UHQ4 | BCAP29 | 0.59963 | cell death GO:0008219 cell differentiation GO:0030154 protein transport GO:0015031 ... |
| 7 | O75752 | B3GALNT1 | 0.57998 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 |
| 8 | Q9BUE0 | MED18 | 0.53 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | P26718 | KLRK1 | 0.50148 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | Q9Y5Q6 | INSL5 | 0.48825 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MMMSDNAKGRAAHSWKKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKHFPVVTVNHILKDVVTSYLQVEEYEP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................ DO_IUPRED2A: DDDD...DDD.DD..D.D..........................DD..D.........D......................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS_MOBI: .................................................................................................... RICH_[W]: WkkrgsisslsnhefW RICH_fLPS_[M]: MMMsdnakgr
120 140 160 AA: ELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE STMI: DO_DISOPRED3: ............................................................................... DO_IUPRED2A: ............................................................................... DO_SPOTD: ............................................................................... CONSENSUS: ............................................................................... CONSENSUS_MOBI: ...............................................................................