Q7Z6V5 ADAT2_HUMAN
Gene name: ADAT2
Protein name: tRNA-specific adenosine deaminase 2
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14862 | AIM2 | 0.91092 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 2 | Q7RTP0 | NIPA1 | 0.86741 | transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q8N4F7 | RNF175 | 0.86737 | catabolic process GO:0009056 response to stress GO:0006950 signal transduction GO:0007165 |
| 4 | Q96S52 | PIGS | 0.86712 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 5 | Q8WWT9 | SLC13A3 | 0.86712 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | Q6DD88 | ATL3 | 0.86703 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 7 | Q96B86 | RGMA | 0.86633 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q9HCM9 | TRIM39 | 0.86633 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 9 | Q69YW2 | STUM | 0.86633 | |
| 10 | Q96FN4 | CPNE2 | 0.86527 |
20 40 60 80 100 AA: MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDD......DDDD..DD.......D.DDDD.D..........................DDDDDDDDDD............................... DO_SPOTD: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS: DDDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[A]: AkAApkpAAsgA RICH_fLPS_[A]: meAkAApkpAAsgAc
120 140 160 180 AA: YVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS STMI: DO_DISOPRED3: ...............................................................................DDDDDDDDDDDD DO_IUPRED2A: ................................................................................DDDDDD..... DO_SPOTD: ...........................................................................DDDDDDDDDDDDDDDD CONSENSUS: ...............................................................................DDDDDDDDDDDD CONSENSUS_MOBI: .........................................................................DDDDDDDDDDDD...... RICH_[K]: KsKvrKKecqK