Q69YW2 STUM_HUMAN

Gene name: STUM
Protein name: Protein stum homolog

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q08AG7 MZT1 0.99984 cell cycle GO:0007049
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
2 Q96FN4 CPNE2 0.99984
3 Q9UFG5 C19orf25 0.99984
4 Q96S52 PIGS 0.99982 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
5 P0DMW5 SMIM10L2B 0.99964
6 Q7RTP0 NIPA1 0.9996 transmembrane transport GO:0055085
transport GO:0006810
7 Q9NUP9 LIN7C 0.99862 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
protein transport GO:0015031
...
8 Q9NVX2 NLE1 0.99862 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
9 Q96T76 MMS19 0.99862 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 Q8N4F7 RNF175 0.99601 catabolic process GO:0009056
response to stress GO:0006950
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MEPSHKDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTFVSAFTVLCGARTDLPDRHVCCVFWLNIAAA
STMI:                                                                      MMMMMMMMMMMMMMMMMMMMM               MMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................
DO_IUPRED2A:             DDD.................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................                     ...............              
CONSENSUS_MOBI:          ..................................................                     ...............              
RICH_[A]:                       AetAAAAAAvAAAdprgA                                                                           
RICH_fLPS_[A]:                kdAetAAAAAAvAAAdprgA                                                                           

                                          120                 140                   
AA:                      LIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQL
STMI:                    MMMMMMM                                  
DO_DISOPRED3:            ................................DD.DDDDDD
DO_IUPRED2A:             .........................................
DO_SPOTD:                ..............................DDDDDDDDDDD
CONSENSUS:                      .........................DDDDDDDDD
CONSENSUS_MOBI:                 ..................................