Q86TU6 CN070_HUMAN
Gene name: LINC00523
Protein name: Putative uncharacterized protein encoded by LINC00523
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O00453 | LST1 | 0.7177 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
2 | Q14152 | EIF3A | 0.66306 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
3 | Q68CJ6 | NUGGC | 0.64544 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell death GO:0008219 |
4 | Q96A44 | SPSB4 | 0.63009 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
5 | Q96I25 | RBM17 | 0.62617 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 mRNA processing GO:0006397 ... |
6 | P52756 | RBM5 | 0.62119 | cell death GO:0008219 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
7 | Q9NZY2 | FAM30A | 0.62079 | |
8 | Q5T200 | ZC3H13 | 0.60903 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
9 | Q14500 | KCNJ12 | 0.60618 | cellular component assembly GO:0022607 circulatory system process GO:0003013 protein-containing complex assembly GO:0065003 ... |
10 | Q96KP6 | TNIP3 | 0.60522 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MGIGTGHTSMNKGGKDVTLLELSVEKRRWRINMETSKIILEKMQSDDVLDGNRERSNEREGRDSLSEKLKSKQNLKDEEKLRYIKTGKSIQVEGTVRAKA STMI: DO_DISOPRED3: DDDDDDDDD........................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDDDDDDDDDDDDDD............................ DO_SPOTD: DDDDDDDDDDDDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................... CONSENSUS: DDDDDDDDDDDDDD................................DDDDDDDDDDDDDDDDDDDDDDDDDD............................ CONSENSUS_MOBI: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................... RICH_[R]: ReRsneRegR RICH_[ER]: RERsnEREgRdslsE RICH_[GM]: MGiGtGhtsM RICH_MOBI_[D]: DDvlDgnrersneregrD RICH_MOBI_[R]: ReRsneRegR RICH_MOBI_[DR]: DDvlDgnReRsneRegRD RICH_MOBI_[ER]: RERsnEREgRdslsE
AA: LRWVQ STMI: DO_DISOPRED3: ..... DO_IUPRED2A: ..... DO_SPOTD: ..... CONSENSUS: ..... CONSENSUS_MOBI: .....