O00453 LST1_HUMAN
Gene name: LST1
Protein name: Leukocyte-specific transcript 1 protein
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- immune system process GO:0002376
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A1B0GTQ4 | MYMX | 0.79093 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 2 | Q9BT56 | SPX | 0.78897 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
| 3 | A8MTB9 | CEACAM18 | 0.77994 | |
| 4 | Q96NB1 | CEP20 | 0.76867 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 5 | Q5XG85 | n/a | 0.7534 | |
| 6 | Q6QEF8 | CORO6 | 0.74094 | cytoskeleton organization GO:0007010 |
| 7 | Q68CJ6 | NUGGC | 0.72882 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell death GO:0008219 |
| 8 | Q14152 | EIF3A | 0.72211 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 9 | Q9NRA2 | SLC17A5 | 0.7211 | transport GO:0006810 |
| 10 | Q86TU6 | LINC00523 | 0.7177 |
20 40 60 80 AA: MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDD................................................................DDDDDDDDDDDDDDD.............DD DO_IUPRED2A: ..................................................................DDDDDDDDDDDDDD.....DD.......... DO_SPOTD: DDDD..........................................DD............DDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDD CONSENSUS: DDD.... ......................................DDDDDDDDDDDDDDDDDDDD.........DD CONSENSUS_MOBI: ....... ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[R]: RgRdkRgtkedpR RICH_MOBI_[D]: DlrgrDkrgtkeDpraD RICH_MOBI_[R]: RlpvpssegpdlRgRdkR RICH_MOBI_[DR]: DlRgRDkRgtkeDpRaD