Q86UQ8 NFE4_HUMAN

Gene name: NFE4
Protein name: Transcription factor NF-E4

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UIG5 PSORS1C1 0.87666
2 Q9H410 DSN1 0.69728 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
3 O95813 CER1 0.67848 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
4 O60906 SMPD2 0.65252 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9H5Q4 TFB2M 0.64948
6 Q8IWF2 FOXRED2 0.64305 catabolic process GO:0009056
response to stress GO:0006950
7 P14859 POU2F1 0.63276 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
8 P16860 NPPB 0.61541 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 Q96M96 FGD4 0.58219 anatomical structure development GO:0048856
cell death GO:0008219
cell morphogenesis GO:0000902
...
10 P01133 EGF 0.56264 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAA
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             .................D..DDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DD.......D..............DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDD
CONSENSUS:               D................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DD.......D..............DDD
CONSENSUS_MOBI:          ...................................................................................................D
RICH_[R]:                                         ReglRssspvdlplRpR                                                          

                                          120                 140                 160 
AA:                      MKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG
STMI:                                                                                                   
DO_DISOPRED3:            .................................................................DD.D.DDDD....D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[Q]:                                                                                 QtpQQlpslhlsQ 
RICH_[T]:                          TqvnpqghapsaedpTgTwT                                                 
RICH_[HQ]:                     HnaQtQvnpQgH                                                             
RICH_[LQ]:                                                                              LeQtpQQLpsLhLsQ 
RICH_MOBI_[L]:                                                                  LpLktdsaLeqtpqqLpsLhL   
RICH_MOBI_[Q]:                                                                            QtpQQlpslhlsQ 
RICH_MOBI_[T]:                     TqvnpqghapsaedpTgTwT                                                 
RICH_MOBI_[HQ]:                HnaQtQvnpQgH                                                             
RICH_MOBI_[LQ]:                                                                 LpLktdsaLeQtpQQLpsLhLsQ