Q86X19 TMM17_HUMAN
Gene name: TMEM17
Protein name: Transmembrane protein 17
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NRR3 | CDC42SE2 | 0.70711 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 signal transduction GO:0007165 ... |
| 2 | Q9HBT6 | CDH20 | 0.64018 | cell adhesion GO:0007155 |
| 3 | Q9UL15 | BAG5 | 0.54352 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 4 | Q5JQF7 | LINC01556 | 0.53067 | |
| 5 | Q9H7R0 | ZNF442 | 0.49936 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q9Y6N8 | CDH10 | 0.49237 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 7 | Q8TAT8 | n/a | 0.43814 | |
| 8 | Q14197 | MRPL58 | 0.39959 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 9 | O95876 | WDPCP | 0.38417 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | P08567 | PLEK | 0.37346 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
20 40 60 80 100 AA: MELPDPVRQRLGNFSRAVFSDSNRTGPESNEGPENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYV STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDD................DDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: ........................DDDDDDDD.................................................................... DO_SPOTD: DDD................DDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDD................DDDDDDDDDDDDDDD.......... ............ .. CONSENSUS_MOBI: ............................................ ............ ..
120 140 160 180 AA: GNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................................................................................DDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................................................. DO_SPOTD: ...................................................................................DDDDDDDDDDDDDDD CONSENSUS: ......... ........... .....................DDDDDDDDDDDDDDD CONSENSUS_MOBI: ......... ........... .................................... RICH_[IR]: RRmRscIeeI