Q8IUX1 T126B_HUMAN
Gene name: TMEM126B
Protein name: Complex I assembly factor TMEM126B, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P17735 | TAT | 0.88124 | biosynthetic process GO:0009058 catabolic process GO:0009056 response to stress GO:0006950 ... |
| 2 | Q9NPA3 | MID1IP1 | 0.81859 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 3 | Q7L985 | LINGO2 | 0.725 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 4 | Q8WW35 | DYNLT2B | 0.725 | cellular component assembly GO:0022607 cytoskeleton-dependent intracellular transport GO:0030705 protein transport GO:0015031 ... |
| 5 | O00219 | HAS3 | 0.68875 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular component assembly GO:0022607 ... |
| 6 | Q8TB61 | SLC35B2 | 0.68875 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 ... |
| 7 | Q5JRX3 | PITRM1 | 0.68875 | protein targeting GO:0006605 protein transport GO:0015031 transport GO:0006810 |
| 8 | Q9C0K7 | STRADB | 0.65534 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 9 | P52740 | ZNF132 | 0.60949 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P04201 | MAS1 | 0.60349 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVK STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.................................................................. DO_IUPRED2A: ..............DDDD.................................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... ........ CONSENSUS_MOBI: ....................................................................... ........ RICH_[V]: VVfgyeagtkprdsgVVpV RICH_[GV]: VVfGyeaGtkprdsGVVpVG
120 140 160 180 200 AA: HDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIP STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ......... .......... ..................................... CONSENSUS_MOBI: ......... .......... .....................................
220 AA: LVFQIMFGILNGLYHYAVFEETLEKTIHEE STMI: MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...........................DDD DO_IUPRED2A: .............................D DO_SPOTD: .........................DDDDD CONSENSUS: ........DDD CONSENSUS_MOBI: ...........