Q8WW35 DYT2B_HUMAN
Gene name: DYNLT2B
Protein name: Dynein light chain Tctex-type protein 2B
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton-dependent intracellular transport GO:0030705
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P17735 | TAT | 0.75277 | biosynthetic process GO:0009058 catabolic process GO:0009056 response to stress GO:0006950 ... |
| 2 | Q8IUX1 | TMEM126B | 0.725 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 3 | Q9NPA3 | MID1IP1 | 0.64443 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 4 | Q9NQ94 | A1CF | 0.50234 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 5 | Q9C0K7 | STRADB | 0.47574 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 6 | Q494W8 | CHRFAM7A | 0.46887 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 7 | Q8NEY3 | SPATA4 | 0.44026 | cytoskeleton organization GO:0007010 |
| 8 | Q9GZV9 | FGF23 | 0.40679 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q14416 | GRM2 | 0.39244 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 10 | Q8IVJ1 | SLC41A1 | 0.38888 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: ...............DDDDDDDDD............................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[GV]: GVsfsVGdGV
120 140 AA: RGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY STMI: DO_DISOPRED3: .......................................... DO_IUPRED2A: .......................................... DO_SPOTD: .......................................... CONSENSUS: .......................................... CONSENSUS_MOBI: ..........................................