Q9NPA3 M1IP1_HUMAN
Gene name: MID1IP1
Protein name: Mid1-interacting protein 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IUX1 | TMEM126B | 0.81859 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 2 | Q9NQ94 | A1CF | 0.79275 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 3 | P17735 | TAT | 0.7336 | biosynthetic process GO:0009058 catabolic process GO:0009056 response to stress GO:0006950 ... |
| 4 | P15502 | ELN | 0.66294 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
| 5 | Q9GZV9 | FGF23 | 0.66152 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | Q8WW35 | DYNLT2B | 0.64443 | cellular component assembly GO:0022607 cytoskeleton-dependent intracellular transport GO:0030705 protein transport GO:0015031 ... |
| 7 | Q7Z3Y9 | KRT26 | 0.6358 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 8 | Q9UPY5 | SLC7A11 | 0.5793 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 9 | Q86XR2 | NIBAN3 | 0.57305 | |
| 10 | Q8WW36 | ZCCHC13 | 0.5696 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
20 40 60 80 100 AA: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRND STMI: DO_DISOPRED3: DDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... DO_IUPRED2A: ................................................DDDD.DDDDDDDDDDDDDDDDDD.DDDDDD...................... DO_SPOTD: DDDDDDDDDD...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................ CONSENSUS: DDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GldndvGvevGGsGG RICH_[V]: VgVeVggsggcleertppV RICH_[GV]: GldndVGVeVGGsGGcleertppV RICH_fLPS_[G]: GldndvGvevGGsGG
120 140 160 180 AA: IEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH STMI: DO_DISOPRED3: ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................DD.DDD DO_IUPRED2A: ....DDDDDDDDDDDDDDDD...........D.....DD............................................ DO_SPOTD: ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDD CONSENSUS: ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................DDDDDD CONSENSUS_MOBI: ...................................................................................