Q8IVP5 FUND1_HUMAN
Gene name: FUNDC1
Protein name: FUN14 domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N1C3 | GABRG1 | 0.83205 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 2 | Q9NUN5 | LMBRD1 | 0.75569 | biological process involved in symbiotic interaction GO:0044403 small molecule metabolic process GO:0044281 |
| 3 | Q92882 | OSTF1 | 0.7361 | immune system process GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
| 4 | P62495 | ETF1 | 0.73106 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q8NE00 | TMEM104 | 0.7175 | |
| 6 | P52434 | POLR2H | 0.70711 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | Q9Y6J8 | STYXL1 | 0.70711 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | Q8N485 | LIX1 | 0.70711 | catabolic process GO:0009056 |
| 9 | P29972 | AQP1 | 0.68662 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 10 | Q6NVV0 | MKRN9P | 0.66227 |
20 40 60 80 100 AA: MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWK STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDD..................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD............................. ...... ..... CONSENSUS_MOBI: ............................................... ...... ..... RICH_fLPS_[D]: ppqDyesDDD
120 140 AA: RVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ....................................................... DO_IUPRED2A: ............D.......................................... DO_SPOTD: ....................................................... CONSENSUS: ................................. . CONSENSUS_MOBI: ................................. .