Q8IWL8 STH_HUMAN

Gene name: STH
Protein name: Saitohin

List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13310 PABPC4 0.82679 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q9NY57 STK32B 0.82157 cellular protein modification process GO:0006464
signal transduction GO:0007165
3 P48549 KCNJ3 0.75011 cell-cell signaling GO:0007267
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
4 Q3ZCQ8 TIMM50 0.68406 cell death GO:0008219
cellular protein modification process GO:0006464
membrane organization GO:0061024
...
5 Q9NQV5 PRDM11 0.68002 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
6 Q96L11 LLCFC1 0.63571
7 P0DMU3 n/a 0.61118
8 Q9BSK4 FEM1A 0.59745
9 Q9BYU1 PBX4 0.59623 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q9NYK6 EURL 0.58952 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80                 100
AA:                      MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPF
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD...............................................................................................
DO_IUPRED2A:             ................................................................................DDDDDDDDDDDDDD....D.
DO_SPOTD:                DDDDD........................................................DDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD...........................................................................DDDDDDDDDDDDDD....D.
CONSENSUS_MOBI:          ............................................................................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[Q]:                                                                                                    QgrQlsiegpf
RICH_MOBI_[GQ]:                                                                                                GaeQGrQlsieGpf

                                          120            
AA:                      QGQNCPSHPAAALPLPMRGESQATSCQV
STMI:                                                
DO_DISOPRED3:            ....................D.DDDDDD
DO_IUPRED2A:             ..........DDDDDD.........D..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........DDDDDD....DDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[Q]:           QgQ                         
RICH_MOBI_[GQ]:          QGQ