Q8IXA5 SACA3_HUMAN

Gene name: SPACA3
Protein name: Sperm acrosome membrane-associated protein 3

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- membrane organization GO:0061024
- reproduction GO:0000003
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8TBY0 RBM46 0.72998 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
2 Q7Z7C7 STRA8 0.72337 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
3 Q9NRW7 VPS45 0.72088 protein transport GO:0015031
response to stress GO:0006950
transport GO:0006810
...
4 Q8TBH0 ARRDC2 0.72088 protein transport GO:0015031
transport GO:0006810
5 Q15118 PDK1 0.72088 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
6 P15907 ST6GAL1 0.72034 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
7 P31358 CD52 0.71049 homeostatic process GO:0042592
8 O15520 FGF10 0.70881 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 Q92503 SEC14L1 0.70758 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
10 Q14416 GRM2 0.70616 cell-cell signaling GO:0007267
homeostatic process GO:0042592
signal transduction GO:0007165
...

                                           20                  40                  60                  80                 100
AA:                      MVSALRGAPLIRVHSSPVSSPSVSGPRRLVSCLSSQSSALSQSGGGSTSAAGIEARSRALRRRWCPAGIMLLALVCLLSCLLPSSEAKLYGRCELARVLH
STMI:                                                                                   MMMMMMMMMMMMMMMMMMMMM                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD.........................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD                     ................
CONSENSUS_MOBI:          ...............................................................                     ................
RICH_[PS]:                       PlirvhSSPvSSPSvSgP                                                                          
RICH_[AG]:                                                     AlsqsGGGstsAAGieArsrA                                         
RICH_[AR]:                                                                AAgieARsRAlRRR                                     
RICH_[AS]:                                                   SSAlSqSgggStSAAgieArS                                           
RICH_[A]:                                                                 AAgieArsrA                                         
RICH_[S]:                  SalrgaplirvhSSpvSSpSvS      SclSSqSSalSqSgggStSaagiearS                                           
RICH_[V]:                            VhsspVsspsVsgprrlV                                                                      
RICH_[SV]:                           VhSSpVSSpSVSgprrlVS                                                                     
RICH_[GR]:                                                          GGGstsaaGieaRsRalRRR                                     
RICH_[GS]:                                                SSqSSalSqSGGGStSaaGiearS                                           
RICH_fLPS_[S]:                         SSpvSSpSvSgprrlvSclSSqSSalSqSgggStS                                                   

                                          120                 140                 160                 180                 200
AA:                      DFGLDGYRGYSLADWVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHH
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                              
AA:                      CQGKDLTEWVDGCDF
STMI:                                   
DO_DISOPRED3:            ...............
DO_IUPRED2A:             ...............
DO_SPOTD:                ...............
CONSENSUS:               ...............
CONSENSUS_MOBI:          ...............