Q8IYL9 PSYR_HUMAN
Gene name: GPR65
Protein name: Psychosine receptor
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q96L58 | B3GALT6 | 0.93912 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
2 | Q5T9C9 | PIP5KL1 | 0.91616 | cell death GO:0008219 cellular protein modification process GO:0006464 |
3 | Q8N6K7 | SAMD3 | 0.90286 | |
4 | Q9GZY8 | MFF | 0.86513 | anatomical structure development GO:0048856 cell death GO:0008219 protein targeting GO:0006605 ... |
5 | Q13393 | PLD1 | 0.86193 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
6 | Q96LR9 | APOLD1 | 0.848 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
7 | P41181 | AQP2 | 0.84549 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
8 | A0A1B0GTL2 | C20orf204 | 0.84215 | |
9 | Q9Y2T4 | PPP2R2C | 0.83761 | cellular protein modification process GO:0006464 |
10 | Q13868 | EXOSC2 | 0.83205 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 growth GO:0040007 ... |
20 40 60 80 100 AA: MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPLWIDYTWNKDNWTFSPALCKGSAFLMYMNFYS STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMM DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDD......................................................................................... CONSENSUS: DDDDDD......... .............. .................. CONSENSUS_MOBI: ............... .............. ..................
120 140 160 180 200 AA: STAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWILETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTIL STMI: MMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................... .............................. CONSENSUS_MOBI: ................... ..............................
220 240 260 280 300 AA: ICNRKVYQAVRHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYD STMI: M MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .......................... ......................... ...... CONSENSUS_MOBI: .......................... ......................... ......
320 AA: MWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE STMI: DO_DISOPRED3: .........DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..................................... DO_SPOTD: .........DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................... RICH_[R]: RcntsqRqRkR