Q8IZS6 DYLT2_HUMAN

Gene name: DYNLT2
Protein name: Dynein light chain Tctex-type protein 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13398 ZNF211 0.80076 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 O95972 BMP15 0.78925 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q8IZC7 ZNF101 0.7879 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 O00168 FXYD1 0.78639 cellular protein modification process GO:0006464
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
5 P41181 AQP2 0.77776 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
6 Q13393 PLD1 0.77299 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
7 Q96NF6 C8orf49 0.71258
8 Q9BY78 RNF26 0.66477 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
9 Q9BSI4 TINF2 0.64672 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
10 Q9GZY8 MFF 0.64466 anatomical structure development GO:0048856
cell death GO:0008219
protein targeting GO:0006605
...

                                           20                  40                  60                  80                 100
AA:                      MEKRGRGVKSSPIQTPNQTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVEPPFDDSIADIGKEWKSALAKLKFANSYRMEPLKKFQAHSV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD...............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................
RICH_[PQ]:                          PiQtPnQtPQQaPvtPrkerrP                                                                   
RICH_[R]:                                           RkeRRpsmfekeaytqilReRlR                                                  
RICH_[ER]:                                          RkERRpsmfEkEaytqilRER                                                    
RICH_[IR]:                                                          IlReRlResI                                               

                                          120                 140                 160                 180  
AA:                      ETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE
STMI:                                                                                                                      
DO_DISOPRED3:            ..................................................................................................
DO_IUPRED2A:             ..................................................................................................
DO_SPOTD:                ..................................................................................................
CONSENSUS:               ..................................................................................................
CONSENSUS_MOBI:          ..................................................................................................