Q8N100 ATOH7_HUMAN

Gene name: ATOH7
Protein name: Protein atonal homolog 7

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86UY8 NT5DC3 0.85918
2 P0DPA2 VSIG8 0.72075
3 O95672 ECEL1 0.71043 signal transduction GO:0007165
4 Q8N465 D2HGDH 0.70739 small molecule metabolic process GO:0044281
5 O43603 GALR2 0.69582 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 P31271 HOXA13 0.66472 anatomical structure development GO:0048856
7 P41134 ID1 0.65319 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 O76014 KRT37 0.65278 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
9 P35030 PRSS3 0.64965 immune system process GO:0002376
protein maturation GO:0051604
small molecule metabolic process GO:0044281
...
10 Q5VUE5 C1orf53 0.63869

                                           20                  40                  60                  80                 100
AA:                      MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD......................DDDDDDDDD...................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AC]:                  CkpsgppAgArvAppCA    CAgtCAgAgrlesAArrrlA                                                        
RICH_[AG]:                      GppAGArvAppcAGGtecAGtcAGAGrlesAA                                                             
RICH_[AP]:                    PsgPPAgArvAPPcAggtecA                                                                          
RICH_[AR]:                                        AgtcAgAgRlesAARRRlAAnAR                                                    
RICH_[A]:                          AgArvAppcAggtecAgtcAgAgrlesAA                                                             
RICH_[C]:                                  CaggteCagtC                                                                       
RICH_[G]:                                    GGtecaGtcaGaG                                                                   
RICH_[R]:                                                 RlesaaRRRlaanaR                                                    
RICH_[CG]:                  CkpsGppaGarvappCaGGteCaGtCaGaG                                                                   
RICH_[CP]:                  CkPsgPPagarvaPPC                                                                                 
RICH_[CR]:                                       CagtCagagRlesaaRRR                                                          
RICH_[GP]:                    PsGPPaGarvaPPcaGGtecaG                                                                         
RICH_fLPS_[A]:                                    AgtcAgAgrlesAArrrlAAnA                                                     
RICH_fLPS_[C]:                         vappCaggteCagtC                                                                       

                                          120                 140        
AA:                      RFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
STMI:                                                                        
DO_DISOPRED3:            ....DD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....................................................
DO_SPOTD:                ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................
RICH_[FQ]:                                                    QrlFgFQpepFQ   
RICH_[LY]:                                   YLpfpgakLpgeseLYsqrL