P41134 ID1_HUMAN

Gene name: ID1
Protein name: DNA-binding protein inhibitor ID-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y584 TIMM22 0.86205 membrane organization GO:0061024
protein targeting GO:0006605
protein transport GO:0015031
...
2 Q96H72 SLC39A13 0.85764 anatomical structure development GO:0048856
homeostatic process GO:0042592
transmembrane transport GO:0055085
...
3 Q9C029 TRIM7 0.85576 cellular protein modification process GO:0006464
4 Q96CN7 ISOC1 0.85155
5 P86791 CCZ1 0.85069 transport GO:0006810
vesicle-mediated transport GO:0016192
6 P31271 HOXA13 0.818 anatomical structure development GO:0048856
7 Q96JI7 SPG11 0.80894 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
8 Q9Y508 RNF114 0.7674 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
9 O15212 PFDN6 0.76004 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
10 Q9NUP9 LIN7C 0.7514 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVID
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AC]:                               CAlkAgktAsgAgevvrC                                                                  
RICH_[AG]:                         AAAGpscAlkAGktAsGAG           AisrcAGGAGArlpA                                             
RICH_[A]:                   AsgstAtAAAgpscAlkAgktAsgA            AisrcAggAgArlpA                                             
RICH_[V]:                                              VVrclseqsV                                                            
RICH_[CV]:                                             VVrClseqsVaisrC                                                       
RICH_fLPS_[A]:              AsgstAtAAAgpscAlkAgktAsgA                                                                        

                                          120                 140     
AA:                      YIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
STMI:                                                                           
DO_DISOPRED3:            .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.
DO_IUPRED2A:             .............D.D.D.DD..................................
DO_SPOTD:                ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:          .......................................................
RICH_[AC]:                                                    AltAeAACvpAddrilC 
RICH_[A]:                                                     AltAeAAcvpA       
RICH_[C]:                                                            CvpaddrilC 
RICH_fLPS_[A]:                                                AltAeAAcvpA