Q8N2C9 UMAS1_HUMAN
Gene name: UMODL1-AS1
Protein name: Uncharacterized protein UMODL1-AS1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P55287 | CDH11 | 0.7094 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | A0A1B0GVZ9 | TMEM269 | 0.68744 | |
| 3 | Q8IW03 | SIAH3 | 0.64834 | anatomical structure development GO:0048856 catabolic process GO:0009056 protein targeting GO:0006605 ... |
| 4 | P46776 | RPL27A | 0.64796 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | P06702 | S100A9 | 0.63294 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | Q9NP94 | SLC39A2 | 0.61916 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q9NUM3 | SLC39A9 | 0.60959 | transport GO:0006810 |
| 8 | Q9UI32 | GLS2 | 0.60296 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 9 | P14373 | TRIM27 | 0.55375 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 10 | Q15319 | POU4F3 | 0.54957 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
20 40 60 80 100 AA: MAWGLPCHQNTAGANPHLFLGCYSTSSLQGLEYGGQRGDAHGKPGVLHGELEPHDHTSRLERHDLHSQLPTSVQVRHHWWEGALDLAKKRQQQTSINVFT STMI: DO_DISOPRED3: DDDD...D......................DDDDDDDDDD...D........................................................ DO_IUPRED2A: ......D.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................D... DO_SPOTD: DDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................. CONSENSUS: DDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................. CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GGqrGdahGkpGvlhG RICH_[H]: HgkpgvlHgelepHdHtsrlerHdlH RICH_[GH]: GGqrGdaHGkpGvlHGelepHdH RICH_[HL]: LHgeLepHdHtsrLerHdLH RICH_fLPS_[G]: GGqrGdahGkpGvlhG RICH_fLPS_[H]: lHgelepHdHtsrlerHdlH
120 140 160 AA: TIKQGSRCDRWMVLGAISLLYNQEEAPDDRPLRARREVRSQHLSWAFPGTAGPGLVCAGDSQ STMI: DO_DISOPRED3: .............................................................D DO_IUPRED2A: ..........................DDDDDDDDDD......DD.............DDD.. DO_SPOTD: ..........................................................DDDD CONSENSUS: ..........................................................DDDD CONSENSUS_MOBI: ..............................................................