Q9NP94 S39A2_HUMAN
Gene name: SLC39A2
Protein name: Zinc transporter ZIP2
List of terms from Generic GO subset, which this protein is a part of:
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IW03 | SIAH3 | 0.98058 | anatomical structure development GO:0048856 catabolic process GO:0009056 protein targeting GO:0006605 ... |
| 2 | Q96EU7 | C1GALT1C1 | 0.84013 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | Q7Z5A9 | TAFA1 | 0.8151 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 4 | Q9NUM3 | SLC39A9 | 0.79399 | transport GO:0006810 |
| 5 | P05154 | SERPINA5 | 0.78634 | anatomical structure development GO:0048856 membrane organization GO:0061024 reproduction GO:0000003 ... |
| 6 | Q9P0M4 | IL17C | 0.75349 | cell-cell signaling GO:0007267 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q6UXZ4 | UNC5D | 0.70881 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 8 | Q15319 | POU4F3 | 0.70856 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 9 | Q9BRI3 | SLC30A2 | 0.70445 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | P55287 | CDH11 | 0.67467 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAGFMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHM STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..........D...DD.DD.DDDDDDDDDDDD..D.D............................................................... DO_IUPRED2A: ..........................................................................................DDD....... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: ........ DDDDDD........... ................................. CONSENSUS_MOBI: ........ ................. .................................
120 140 160 180 200 AA: EYPYGELIISLGFFFVFFLESLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEGLAVGLQPTVAATVQLCLAVL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMM DO_DISOPRED3: ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................ CONSENSUS: ... ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..... .... CONSENSUS_MOBI: ... ........................................ .... RICH_[H]: HifelHsHgH RICH_fLPS_[H]: ewggaHifelHsHgH
220 240 260 280 300 AA: AHKGLVVFGVGMRLVHLGTSSRWAVFSILLLALMSPLGLAVGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPRELASPEAPLAKWSCVAAGFA STMI: MMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .............. ............. ......... CONSENSUS_MOBI: .............. ............. .........
AA: FMAFIALWA STMI: MMMMMMMMM DO_DISOPRED3: ......... DO_IUPRED2A: ......... DO_SPOTD: ......... CONSENSUS: CONSENSUS_MOBI: