P46776 RL27A_HUMAN
Gene name: RPL27A
Protein name: 60S ribosomal protein L27a
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P55287 | CDH11 | 0.65083 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q8N2C9 | UMODL1-AS1 | 0.64796 | |
| 3 | P61313 | RPL15 | 0.62798 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | P06702 | S100A9 | 0.61345 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | P05111 | INHA | 0.61033 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | P0DN25 | C1GALT1C1L | 0.6101 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | Q9H6R3 | ACSS3 | 0.57806 | biosynthetic process GO:0009058 generation of precursor metabolites and energy GO:0006091 small molecule metabolic process GO:0044281 |
| 8 | Q15825 | CHRNA6 | 0.54754 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 9 | P15515 | HTN1 | 0.53946 | anatomical structure development GO:0048856 immune system process GO:0002376 response to stress GO:0006950 |
| 10 | Q9H6F2 | TMEM38A | 0.53882 | circulatory system process GO:0003013 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPI STMI: DO_DISOPRED3: DDDD...D....DDD.DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................D.DD....... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........DDDDDD.................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: D................................................................................................... RICH_[G]: GhvshGhGriGkhrkhpGGrGnaGG RICH_[H]: HvsHgHgrigkHrkH RICH_[R]: RlRktRklRghvshghgRigkhR RICH_[GH]: GHvsHGHGriGkHrkHpGGrGnaGGlHHH RICH_[GR]: RlRktRklRGhvshGhGRiGkhR RICH_[HR]: RktRklRgHvsHgHgRigkHRkH RICH_fLPS_[G]: GhvshGhGriGkhrkhpGGrGnaGG RICH_fLPS_[H]: HvsHgHgrigkHrkHpggrgnagglHHH RICH_fLPS_[HG]: GHvsHGHGriGkHrkHpGGrGnaGGlHHH
120 140 AA: IDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACVLVA STMI: DO_DISOPRED3: ................................................ DO_IUPRED2A: ................................................ DO_SPOTD: ................................................ CONSENSUS: ................................................ CONSENSUS_MOBI: ................................................