Q8N6F7 GCSAM_HUMAN
Gene name: GCSAM
Protein name: Germinal center-associated signaling and motility protein
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q16595 | FXN | 0.87084 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 2 | Q8NBM4 | UBAC2 | 0.74706 | catabolic process GO:0009056 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 3 | Q6ZSC3 | RBM43 | 0.71114 | |
| 4 | O43897 | TLL1 | 0.69441 | anatomical structure development GO:0048856 cell differentiation GO:0030154 extracellular matrix organization GO:0030198 |
| 5 | Q96RD7 | PANX1 | 0.68784 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 6 | Q9HBI5 | C3orf14 | 0.68122 | |
| 7 | Q8NEH6 | MNS1 | 0.64753 | anatomical structure development GO:0048856 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 8 | P59510 | ADAMTS20 | 0.64286 | cell death GO:0008219 cell differentiation GO:0030154 extracellular matrix organization GO:0030198 ... |
| 9 | Q99677 | LPAR4 | 0.63783 | homeostatic process GO:0042592 signal transduction GO:0007165 |
| 10 | Q5MAI5 | CDKL4 | 0.58505 | cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSG STMI: DO_DISOPRED3: DDDDDDDDD....D..............................................DDDDDDDDDDDDD........................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDD..................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDD......................... CONSENSUS_MOBI: .................................................................................................... RICH_[QR]: RenRRQQntQ RICH_[N]: NsllreNrrqqNtqempwN RICH_[R]: RenRRqqntqempwnvR RICH_[MQ]: QQntQeMpwnvrM RICH_[NQ]: NsllreNrrQQNtQ
120 140 160 AA: NSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL STMI: DO_DISOPRED3: ..............................................................DDDDDDDDDDDDDDDD DO_IUPRED2A: .....DDDDDD.DDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDD...DDDDDDDDDDDDDDDDD.D DO_SPOTD: ..............DDDDDDDDD.................................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............DDDDDDDDD....................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..............................................................................