Q9HBI5 CC014_HUMAN

Gene name: C3orf14
Protein name: Uncharacterized protein C3orf14

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96LD1 SGCZ 0.78632 anatomical structure development GO:0048856
cell differentiation GO:0030154
circulatory system process GO:0003013
...
2 Q9HD43 PTPRH 0.78632 cell death GO:0008219
cellular protein modification process GO:0006464
3 Q16595 FXN 0.77032 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
4 Q8N6F7 GCSAM 0.68122 immune system process GO:0002376
signal transduction GO:0007165
5 Q8NAB2 KBTBD3 0.61782
6 Q9ULI1 NWD2 0.61782
7 Q6ZWT7 MBOAT2 0.58816 biosynthetic process GO:0009058
8 Q9BZX2 UCK2 0.58632 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
9 P18075 BMP7 0.5526 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 Q9H1N7 SLC35B3 0.5515 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281

                                           20                  40                  60                  80                 100
AA:                      MTSLFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSLQTRIHPLPRPEVVSLETRYWASVEEYIPKWEQ
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             .............................D....DDDDDDDDDDD.......................DD.D............................
DO_SPOTD:                DDD..........................DDDDDDDDDDDDD..........................................................
CONSENSUS:               D............................D....DDDDDDDD..........................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120            
AA:                      FLLGRAPYPFAVENQNEAENTIQNEAQR
STMI:                                                
DO_DISOPRED3:            ................DDDDDDDDDDDD
DO_IUPRED2A:             ............DDDDDDDDDDDDDDDD
DO_SPOTD:                ..........DDDDDDDDDDDDDDDDDD
CONSENSUS:               ............DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............................
RICH_[N]:                             NqNeaeNtiqN    
RICH_[NQ]:                            NQNeaeNtiQNeaQ